PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK39850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 171aa    MW: 19875.1 Da    PI: 7.0587
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK39850.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.18.1e-1387140558
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                 +++rr+ +NRe+ArrsR RK+  ++eL   v  L +eN  L+++l++ +++ ++
  KFK39850.1  87 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSENQDS 140
                 79*********************************************9987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-1483147IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.87585148IPR004827Basic-leucine zipper domain
PfamPF001707.0E-1187145IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.5E-1087159No hitNo description
SuperFamilySSF579595.06E-1287136No hitNo description
CDDcd147025.73E-1888136No hitNo description
PROSITE patternPS00036090105IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MIPAEITGYF QYISPENLTT IPAEFNIINM PSSPTSSSSL NYLNDLIINN NNNYSSSSNG  60
QDFMMSNNST SDEDHHHHQS IIILDERKQR RMLSNRESAR RSRMRKQRHL DELWSQVIRL  120
RNENNCLIDK LNRVSENQDS VLKENSKLKE EASDLRQLVC ELKSSKNNSF L
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199106RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00262DAPTransfer from AT2G04038Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613647.11e-101PREDICTED: basic leucine zipper 43
SwissprotQ9FMC21e-32BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A087HCJ81e-121A0A087HCJ8_ARAAL; Uncharacterized protein
STRINGBra017359.1-P1e-90(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04038.16e-69basic leucine-zipper 48